MAGEB1,CT3.1,DAM10
  • MAGEB1,CT3.1,DAM10

Anti-MAGEB1 Antibody 25ul

Ref: AN-HPA002820-25ul
Anti-MAGEB1

Información del producto

Polyclonal Antibody against Human MAGEB1, Gene description: melanoma antigen family B, 1, Alternative Gene Names: CT3.1, DAM10, MAGE-Xp, MAGEL1, MGC9322, Validated applications: IHC, Uniprot ID: P43366, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name MAGEB1
Gene Description melanoma antigen family B, 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence LKVAHATAAEKEECPSSSPVLGDTPTSSPAAGIPQKPQGAPPTTTAAAAVSCTESDEGAKCQGEENASFSQATTSTESSVKDPVAWEAGMLMHFILRKYKMREPIMKADMLKVVDEKYKDHFTEILNGASR
Immunogen LKVAHATAAEKEECPSSSPVLGDTPTSSPAAGIPQKPQGAPPTTTAAAAVSCTESDEGAKCQGEENASFSQATTSTESSVKDPVAWEAGMLMHFILRKYKMREPIMKADMLKVVDEKYKDHFTEILNGASR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CT3.1, DAM10, MAGE-Xp, MAGEL1, MGC9322
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P43366
HTS Code 3002150000
Gene ID 4112
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-MAGEB1 Antibody 25ul

Anti-MAGEB1 Antibody 25ul