NDUFB7,B18,CI-B18
  • NDUFB7,B18,CI-B18

Anti-NDUFB7 Antibody 100ul

Ref: AN-HPA002817-100ul
Anti-NDUFB7

Información del producto

Polyclonal Antibody against Human NDUFB7, Gene description: NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 7, 18kDa, Alternative Gene Names: B18, CI-B18, MGC2480, Validated applications: IHC, WB, Uniprot ID: P17568, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name NDUFB7
Gene Description NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 7, 18kDa
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications IHC, WB
Sequence FPERKEREMVATQQEMMDAQLRLQLRDYCAHHLIRLLKCKRDSFPNFLACKQERHDWDYCEHRDYVMRMKEFERERRLLQRKKRREKKAAELAKGQGPGEVDPKV
Immunogen FPERKEREMVATQQEMMDAQLRLQLRDYCAHHLIRLLKCKRDSFPNFLACKQERHDWDYCEHRDYVMRMKEFERERRLLQRKKRREKKAAELAKGQGPGEVDPKV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names B18, CI-B18, MGC2480
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P17568
HTS Code 3002150000
Gene ID 4713
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-NDUFB7 Antibody 100ul

Anti-NDUFB7 Antibody 100ul