IFIH1,Hlcd,IDDM19
  • IFIH1,Hlcd,IDDM19

Anti-IFIH1 Antibody 25ul

Ref: AN-HPA002656-25ul
Anti-IFIH1

Información del producto

Polyclonal Antibody against Human IFIH1, Gene description: interferon induced with helicase C domain 1, Alternative Gene Names: Hlcd, IDDM19, MDA-5, MDA5, Validated applications: IHC, WB, Uniprot ID: Q9BYX4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name IFIH1
Gene Description interferon induced with helicase C domain 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence TIRMIDAYTHLETFYNEEKDKKFAVIEDDSDEGGDDEYCDGDEDEDDLKKPLKLDETDRFLMTLFFENNKMLKRLAENPEYENEKLTKLRNTIMEQYTRTEESARGIIFTKTRQSAYALSQWITENEKFAEVGVKAHHLIGAGHSSEFKP
Immunogen TIRMIDAYTHLETFYNEEKDKKFAVIEDDSDEGGDDEYCDGDEDEDDLKKPLKLDETDRFLMTLFFENNKMLKRLAENPEYENEKLTKLRNTIMEQYTRTEESARGIIFTKTRQSAYALSQWITENEKFAEVGVKAHHLIGAGHSSEFKP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Hlcd, IDDM19, MDA-5, MDA5
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BYX4
HTS Code 3002150000
Gene ID 64135
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-IFIH1 Antibody 25ul

Anti-IFIH1 Antibody 25ul