RAF1,c-Raf,CRAF
  • RAF1,c-Raf,CRAF

Anti-RAF1 Antibody 100ul

Ref: AN-HPA002640-100ul
Anti-RAF1

Información del producto

Polyclonal Antibody against Human RAF1, Gene description: Raf-1 proto-oncogene, serine/threonine kinase, Alternative Gene Names: c-Raf, CRAF, Raf-1, Validated applications: ICC, IHC, Uniprot ID: P04049, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name RAF1
Gene Description Raf-1 proto-oncogene, serine/threonine kinase
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence FRCQTCGYKFHEHCSTKVPTMCVDWSNIRQLLLFPNSTIGDSGVPALPSLTMRRMRESVSRMPVSSQHRYSTPHAFTFNTSSPSSEGSLSQRQRSTSTPNVHMVSTTLPVDSRMIEDAIRSHSESASPSALSSSPNNLSPTGWSQ
Immunogen FRCQTCGYKFHEHCSTKVPTMCVDWSNIRQLLLFPNSTIGDSGVPALPSLTMRRMRESVSRMPVSSQHRYSTPHAFTFNTSSPSSEGSLSQRQRSTSTPNVHMVSTTLPVDSRMIEDAIRSHSESASPSALSSSPNNLSPTGWSQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names c-Raf, CRAF, Raf-1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P04049
HTS Code 3002150000
Gene ID 5894
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-RAF1 Antibody 100ul

Anti-RAF1 Antibody 100ul