EIF1AX,eIF-1A
  • EIF1AX,eIF-1A

Anti-EIF1AX Antibody 25ul

Ref: AN-HPA002561-25ul
Anti-EIF1AX

Información del producto

Polyclonal Antibody against Human EIF1AX, Gene description: eukaryotic translation initiation factor 1A, X-linked, Alternative Gene Names: eIF-1A, eIF-4C, EIF1A, EIF4C, Validated applications: IHC, WB, Uniprot ID: P47813, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name EIF1AX
Gene Description eukaryotic translation initiation factor 1A, X-linked
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications IHC, WB
Sequence KRELVFKEDGQEYAQVIKMLGNGRLEALCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQ
Immunogen KRELVFKEDGQEYAQVIKMLGNGRLEALCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names eIF-1A, eIF-4C, EIF1A, EIF4C
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P47813
HTS Code 3002150000
Gene ID 1964
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-EIF1AX Antibody 25ul

Anti-EIF1AX Antibody 25ul