LRRC75B,C22orf36
  • LRRC75B,C22orf36

Anti-LRRC75B Antibody 25ul

Ref: AN-HPA002540-25ul
Anti-LRRC75B

Información del producto

Polyclonal Antibody against Human LRRC75B, Gene description: leucine rich repeat containing 75B, Alternative Gene Names: C22orf36, FAM211B, MGC131773, Validated applications: IHC, Uniprot ID: Q2VPJ9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name LRRC75B
Gene Description leucine rich repeat containing 75B
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence DVQHITRYLSSHGAVLAVLDLSFTGLSDELLHLLLPSLWALPRLTQLLLNGNRLTRATARKLTDAIKDTTKFPALAWVDLGNNVDVASLPQPLLVGLRRRLSQRTSLPTIYEGLDLEPEGSAAGATTPASTWDS
Immunogen DVQHITRYLSSHGAVLAVLDLSFTGLSDELLHLLLPSLWALPRLTQLLLNGNRLTRATARKLTDAIKDTTKFPALAWVDLGNNVDVASLPQPLLVGLRRRLSQRTSLPTIYEGLDLEPEGSAAGATTPASTWDS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C22orf36, FAM211B, MGC131773
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q2VPJ9
HTS Code 3002150000
Gene ID 388886
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-LRRC75B Antibody 25ul

Anti-LRRC75B Antibody 25ul