COX4I1,COX4,COX4-1
  • COX4I1,COX4,COX4-1

Anti-COX4I1 Antibody 25ul

Ref: AN-HPA002485-25ul
Anti-COX4I1

Información del producto

Polyclonal Antibody against Human COX4I1, Gene description: cytochrome c oxidase subunit IV isoform 1, Alternative Gene Names: COX4, COX4-1, Validated applications: ICC, IHC, Uniprot ID: P13073, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name COX4I1
Gene Description cytochrome c oxidase subunit IV isoform 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence LATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKT
Immunogen LATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names COX4, COX4-1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P13073
HTS Code 3002150000
Gene ID 1327
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-COX4I1 Antibody 25ul

Anti-COX4I1 Antibody 25ul