LMAN1,ERGIC-53
  • LMAN1,ERGIC-53

Anti-LMAN1 Antibody 100ul

Ref: AN-HPA002320-100ul
Anti-LMAN1

Información del producto

Polyclonal Antibody against Human LMAN1, Gene description: lectin, mannose-binding, 1, Alternative Gene Names: ERGIC-53, ERGIC53, F5F8D, FMFD1, gp58, MCFD1, MR60, Validated applications: IHC, WB, Uniprot ID: P49257, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name LMAN1
Gene Description lectin, mannose-binding, 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence IGNNGQIHYDHQNDGASQALASCQRDFRNKPYPVRAKITYYQNTLTVMINNGFTPDKNDYEFCAKVENMIIPAQGHFGISAATGGLADDHDVLSFLTFQLTEPGKEP
Immunogen IGNNGQIHYDHQNDGASQALASCQRDFRNKPYPVRAKITYYQNTLTVMINNGFTPDKNDYEFCAKVENMIIPAQGHFGISAATGGLADDHDVLSFLTFQLTEPGKEP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ERGIC-53, ERGIC53, F5F8D, FMFD1, gp58, MCFD1, MR60
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P49257
HTS Code 3002150000
Gene ID 3998
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-LMAN1 Antibody 100ul

Anti-LMAN1 Antibody 100ul