A2M,CPAMD5,FWP007
  • A2M,CPAMD5,FWP007

Anti-A2M Antibody 25ul

Ref: AN-HPA002265-25ul
Anti-A2M

Información del producto

Polyclonal Antibody against Human A2M, Gene description: alpha-2-macroglobulin, Alternative Gene Names: CPAMD5, FWP007, S863-7, Validated applications: IHC, WB, Uniprot ID: P01023, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name A2M
Gene Description alpha-2-macroglobulin
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence SVLLMKPDAELSASSVYNLLPEKDLTGFPGPLNDQDDEDCINRHNVYINGITYTPVSSTNEKDMYSFLEDMGLKAFTNSKIRKPKMCPQLQQYEMHGPEGLRVGFYESDVMGRGHARLVHVEEPHTETVRKYFPETWIWDLVVVNS
Immunogen SVLLMKPDAELSASSVYNLLPEKDLTGFPGPLNDQDDEDCINRHNVYINGITYTPVSSTNEKDMYSFLEDMGLKAFTNSKIRKPKMCPQLQQYEMHGPEGLRVGFYESDVMGRGHARLVHVEEPHTETVRKYFPETWIWDLVVVNS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CPAMD5, FWP007, S863-7
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P01023
HTS Code 3002150000
Gene ID 2
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-A2M Antibody 25ul

Anti-A2M Antibody 25ul