IGFBP7,FSTL2
  • IGFBP7,FSTL2

Anti-IGFBP7 Antibody 25ul

Ref: AN-HPA002196-25ul
Anti-IGFBP7

Información del producto

Polyclonal Antibody against Human IGFBP7, Gene description: insulin-like growth factor binding protein 7, Alternative Gene Names: FSTL2, IGFBP-7, MAC25, PSF, Validated applications: IHC, Uniprot ID: Q16270, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name IGFBP7
Gene Description insulin-like growth factor binding protein 7
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence EQGPSIVTPPKDIWNVTGAQVYLSCEVIGIPTPVLIWNKVKRGHYGVQRTELLPGDRDNLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQA
Immunogen EQGPSIVTPPKDIWNVTGAQVYLSCEVIGIPTPVLIWNKVKRGHYGVQRTELLPGDRDNLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FSTL2, IGFBP-7, MAC25, PSF
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q16270
HTS Code 3002150000
Gene ID 3490
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-IGFBP7 Antibody 25ul

Anti-IGFBP7 Antibody 25ul