IGF2BP3,CT98,IMP-3
  • IGF2BP3,CT98,IMP-3

Anti-IGF2BP3 Antibody 25ul

Ref: AN-HPA002037-25ul
Anti-IGF2BP3

Información del producto

Polyclonal Antibody against Human IGF2BP3, Gene description: insulin-like growth factor 2 mRNA binding protein 3, Alternative Gene Names: CT98, IMP-3, IMP3, Validated applications: IHC, WB, Uniprot ID: O00425, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name IGF2BP3
Gene Description insulin-like growth factor 2 mRNA binding protein 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence VVESCEQVNTDSETAVVNVTYSSKDQARQALDKLNGFQLENFTLKVAYIPDEMAAQQNPLQQPRGRRGLGQRGSSRQGSPGSVSKQKPCDLPLRLLVPTQFVGAIIGKEGATIRNITKQTQ
Immunogen VVESCEQVNTDSETAVVNVTYSSKDQARQALDKLNGFQLENFTLKVAYIPDEMAAQQNPLQQPRGRRGLGQRGSSRQGSPGSVSKQKPCDLPLRLLVPTQFVGAIIGKEGATIRNITKQTQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CT98, IMP-3, IMP3
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O00425
HTS Code 3002150000
Gene ID 10643
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-IGF2BP3 Antibody 25ul

Anti-IGF2BP3 Antibody 25ul