MBL2,COLEC1,MBL
  • MBL2,COLEC1,MBL

Anti-MBL2 Antibody 100ul

Ref: AN-HPA002027-100ul
Anti-MBL2

Información del producto

Polyclonal Antibody against Human MBL2, Gene description: mannose-binding lectin (protein C) 2, soluble, Alternative Gene Names: COLEC1, MBL, Validated applications: IHC, WB, Uniprot ID: P11226, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MBL2
Gene Description mannose-binding lectin (protein C) 2, soluble
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence DGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSH
Immunogen DGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSH
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names COLEC1, MBL
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P11226
HTS Code 3002150000
Gene ID 4153
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-MBL2 Antibody 100ul

Anti-MBL2 Antibody 100ul