TSC22D3,DIP,DSIPI
  • TSC22D3,DIP,DSIPI

Anti-TSC22D3 Antibody 25ul

Ref: AN-HPA001916-25ul
Anti-TSC22D3

Información del producto

Polyclonal Antibody against Human TSC22D3, Gene description: TSC22 domain family, member 3, Alternative Gene Names: DIP, DSIPI, GILZ, hDIP, TSC-22R, Validated applications: ICC, Uniprot ID: Q99576, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TSC22D3
Gene Description TSC22 domain family, member 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence MAQSKLDCRSPVGLDCCNCCLDLAHRSGLQRGSSGENNNPGSPTVSNFRQLQEKLVFENLNTDKLNSIMRQDSLEPVLRDPCYLINEGICNRNIDQTMLSILLFFH
Immunogen MAQSKLDCRSPVGLDCCNCCLDLAHRSGLQRGSSGENNNPGSPTVSNFRQLQEKLVFENLNTDKLNSIMRQDSLEPVLRDPCYLINEGICNRNIDQTMLSILLFFH
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DIP, DSIPI, GILZ, hDIP, TSC-22R
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q99576
HTS Code 3002150000
Gene ID 1831
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TSC22D3 Antibody 25ul

Anti-TSC22D3 Antibody 25ul