STAT6,D12S1644
  • STAT6,D12S1644

Anti-STAT6 Antibody 25ul

Ref: AN-HPA001861-25ul
Anti-STAT6

Información del producto

Polyclonal Antibody against Human STAT6, Gene description: signal transducer and activator of transcription 6, interleukin-4 induced, Alternative Gene Names: D12S1644, IL-4-STAT, Validated applications: ICC, IHC, WB, Uniprot ID: P42226, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name STAT6
Gene Description signal transducer and activator of transcription 6, interleukin-4 induced
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence VYPPHSHSIPPYQGLSPEESVNVLSAFQEPHLQMPPSLGQMSLPFDQPHPQGLLPCQPQEHAVSSPDPLLCSDVTMVEDSCLSQPVTAFPQGTWIGEDIFPPLLPPTEQDLTKLLLEGQGESGGGSLGAQPLLQPSHYGQSGISMSHMDLR
Immunogen VYPPHSHSIPPYQGLSPEESVNVLSAFQEPHLQMPPSLGQMSLPFDQPHPQGLLPCQPQEHAVSSPDPLLCSDVTMVEDSCLSQPVTAFPQGTWIGEDIFPPLLPPTEQDLTKLLLEGQGESGGGSLGAQPLLQPSHYGQSGISMSHMDLR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names D12S1644, IL-4-STAT
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P42226
HTS Code 3002150000
Gene ID 6778
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-STAT6 Antibody 25ul

Anti-STAT6 Antibody 25ul