INTS6,DBI-1,DDX26
  • INTS6,DBI-1,DDX26

Anti-INTS6 Antibody 25ul

Ref: AN-HPA001846-25ul
Anti-INTS6

Información del producto

Polyclonal Antibody against Human INTS6, Gene description: integrator complex subunit 6, Alternative Gene Names: DBI-1, DDX26, DDX26A, DICE1, HDB, INT6, Notchl2, Validated applications: ICC, IHC, WB, Uniprot ID: Q9UL03, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name INTS6
Gene Description integrator complex subunit 6
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence VVNNHIGGKGPPAPTTQAQPDLIKPLPLHKISETTNDSIIHDVVENHVADQLSSDITPNAMDTEFSASSPASLLERPTNHMEALGHDHLGTNDLTVGGFLENHEEPRDKEQCAEENIPASSLNKGKKLMHCRSHEEVNTELKAQ
Immunogen VVNNHIGGKGPPAPTTQAQPDLIKPLPLHKISETTNDSIIHDVVENHVADQLSSDITPNAMDTEFSASSPASLLERPTNHMEALGHDHLGTNDLTVGGFLENHEEPRDKEQCAEENIPASSLNKGKKLMHCRSHEEVNTELKAQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DBI-1, DDX26, DDX26A, DICE1, HDB, INT6, Notchl2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UL03
HTS Code 3002150000
Gene ID 26512
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-INTS6 Antibody 25ul

Anti-INTS6 Antibody 25ul