DIABLO,DFNA64
  • DIABLO,DFNA64

Anti-DIABLO Antibody 25ul

Ref: AN-HPA001825-25ul
Anti-DIABLO

Información del producto

Polyclonal Antibody against Human DIABLO, Gene description: diablo, IAP-binding mitochondrial protein, Alternative Gene Names: DFNA64, DIABLO-S, FLJ10537, FLJ25049, SMAC, Validated applications: ICC, IHC, Uniprot ID: Q9NR28, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name DIABLO
Gene Description diablo, IAP-binding mitochondrial protein
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence AVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEG
Immunogen AVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DFNA64, DIABLO-S, FLJ10537, FLJ25049, SMAC
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NR28
HTS Code 3002150000
Gene ID 56616
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-DIABLO Antibody 25ul

Anti-DIABLO Antibody 25ul