MZF1,MZF-1,MZF1B
  • MZF1,MZF-1,MZF1B

Anti-MZF1 Antibody 100ul

Ref: AN-HPA001757-100ul
Anti-MZF1

Información del producto

Polyclonal Antibody against Human MZF1, Gene description: myeloid zinc finger 1, Alternative Gene Names: MZF-1, MZF1B, Zfp98, ZNF42, ZSCAN6, Validated applications: ICC, IHC, Uniprot ID: P28698, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MZF1
Gene Description myeloid zinc finger 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence TLTQHLRVHTGEKPFACPECGQRFSQRLKLTRHQRTHTGEKPYHCGECGLGFTQVSRLTEHQRIHTGERPFACPECGQSFRQHANLTQHRRIHTGERPYACPECGKAFRQRPTLTQHLRTHRREKPFACQDCGRRFHQSTK
Immunogen TLTQHLRVHTGEKPFACPECGQRFSQRLKLTRHQRTHTGEKPYHCGECGLGFTQVSRLTEHQRIHTGERPFACPECGQSFRQHANLTQHRRIHTGERPYACPECGKAFRQRPTLTQHLRTHRREKPFACQDCGRRFHQSTK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MZF-1, MZF1B, Zfp98, ZNF42, ZSCAN6
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P28698
HTS Code 3002150000
Gene ID 7593
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-MZF1 Antibody 100ul

Anti-MZF1 Antibody 100ul