DLG5,KIAA0583,P-dlg
  • DLG5,KIAA0583,P-dlg

Anti-DLG5 Antibody 100ul

Ref: AN-HPA001746-100ul
Anti-DLG5

Información del producto

Polyclonal Antibody against Human DLG5, Gene description: discs, large homolog 5 (Drosophila), Alternative Gene Names: KIAA0583, P-dlg, Validated applications: ICC, Uniprot ID: Q8TDM6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name DLG5
Gene Description discs, large homolog 5 (Drosophila)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence FLHKPFPGGPLQVCPQACPSASERSLSSFRSDASGDRGFGLVDVRGRRPLLPFETEVGPCGVGEASLDKADSEGSNSGGTWPKAMLSSTAVPEKLSVYKKPKQRKSI
Immunogen FLHKPFPGGPLQVCPQACPSASERSLSSFRSDASGDRGFGLVDVRGRRPLLPFETEVGPCGVGEASLDKADSEGSNSGGTWPKAMLSSTAVPEKLSVYKKPKQRKSI
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA0583, P-dlg
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8TDM6
HTS Code 3002150000
Gene ID 9231
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-DLG5 Antibody 100ul

Anti-DLG5 Antibody 100ul