DDX3X,DBX,DDX14
  • DDX3X,DBX,DDX14

Anti-DDX3X Antibody 100ul

Ref: AN-HPA001648-100ul
Anti-DDX3X

Información del producto

Polyclonal Antibody against Human DDX3X, Gene description: DEAD (Asp-Glu-Ala-Asp) box helicase 3, X-linked, Alternative Gene Names: DBX, DDX14, DDX3, HLP2, Validated applications: ICC, IHC, WB, Uniprot ID: O00571, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name DDX3X
Gene Description DEAD (Asp-Glu-Ala-Asp) box helicase 3, X-linked
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications ICC, IHC, WB
Sequence LNSSDNQSGGSTASKGRYIPPHLRNREATKGFYDKDSSGWSSSKDKDAYSSFGSRSDSRGKSSFFSDRGSGSRGRFDDRGRSDYDGIGSRGDRSGFGKFERGGNSRWCDKSDEDDWSKPLPPSERLEQELFSGGNTGINFEKYDDIPV
Immunogen LNSSDNQSGGSTASKGRYIPPHLRNREATKGFYDKDSSGWSSSKDKDAYSSFGSRSDSRGKSSFFSDRGSGSRGRFDDRGRSDYDGIGSRGDRSGFGKFERGGNSRWCDKSDEDDWSKPLPPSERLEQELFSGGNTGINFEKYDDIPV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DBX, DDX14, DDX3, HLP2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O00571
HTS Code 3002150000
Gene ID 1654
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-DDX3X Antibody 100ul

Anti-DDX3X Antibody 100ul