TJP1,DKFZp686M05161
  • TJP1,DKFZp686M05161

Anti-TJP1 Antibody 25ul

Ref: AN-HPA001636-25ul
Anti-TJP1

Información del producto

Polyclonal Antibody against Human TJP1, Gene description: tight junction protein 1, Alternative Gene Names: DKFZp686M05161, MGC133289, ZO-1, Validated applications: ICC, IHC, WB, Uniprot ID: Q07157, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TJP1
Gene Description tight junction protein 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence RKLYERSHKLRKNNHHLFTTTINLNSMNDGWYGALKEAIQQQQNQLVWVSEGKADGATSDDLDLHDDRLSYLSAPGSEYSMYSTDSRHTSDYEDTDTEGGAYTDQELDETLNDEVGTPPESAITRSSEPVRED
Immunogen RKLYERSHKLRKNNHHLFTTTINLNSMNDGWYGALKEAIQQQQNQLVWVSEGKADGATSDDLDLHDDRLSYLSAPGSEYSMYSTDSRHTSDYEDTDTEGGAYTDQELDETLNDEVGTPPESAITRSSEPVRED
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DKFZp686M05161, MGC133289, ZO-1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q07157
HTS Code 3002150000
Gene ID 7082
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TJP1 Antibody 25ul

Anti-TJP1 Antibody 25ul