RRP7A,CGI-96
  • RRP7A,CGI-96

Anti-RRP7A Antibody 25ul

Ref: AN-HPA001586-25ul
Anti-RRP7A

Información del producto

Polyclonal Antibody against Human RRP7A, Gene description: ribosomal RNA processing 7 homolog A (S. cerevisiae), Alternative Gene Names: CGI-96, Validated applications: ICC, IHC, Uniprot ID: Q9Y3A4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name RRP7A
Gene Description ribosomal RNA processing 7 homolog A (S. cerevisiae)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence VRQGTKSTWPQKRTLFVLNVPPYCTEESLSRLLSTCGLVQSVELQEKPDLAESPKESRSKFFHPKPVPGFQVAYVVFQKPSGVSAALALKGPLLVSTESHPVKSGIHKWISDYA
Immunogen VRQGTKSTWPQKRTLFVLNVPPYCTEESLSRLLSTCGLVQSVELQEKPDLAESPKESRSKFFHPKPVPGFQVAYVVFQKPSGVSAALALKGPLLVSTESHPVKSGIHKWISDYA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CGI-96
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y3A4
HTS Code 3002150000
Gene ID 27341
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-RRP7A Antibody 25ul

Anti-RRP7A Antibody 25ul