IFNGR2,AF-1,IFNGT1
  • IFNGR2,AF-1,IFNGT1

Anti-IFNGR2 Antibody 25ul

Ref: AN-HPA001535-25ul
Anti-IFNGR2

Información del producto

Polyclonal Antibody against Human IFNGR2, Gene description: interferon gamma receptor 2 (interferon gamma transducer 1), Alternative Gene Names: AF-1, IFNGT1, Validated applications: ICC, IHC, Uniprot ID: P38484, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name IFNGR2
Gene Description interferon gamma receptor 2 (interferon gamma transducer 1)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence ASPSAGFPMDFNVTLRLRAELGALHSAWVTMPWFQHYRNVTVGPPENIEVTPGEGSLIIRFSSPFDIADTSTAFFCYYVHYWEKGGIQQVKGPFRSNSISLDNLKPSRVYCLQVQAQLLWNKSNIFRVGHLSNIS
Immunogen ASPSAGFPMDFNVTLRLRAELGALHSAWVTMPWFQHYRNVTVGPPENIEVTPGEGSLIIRFSSPFDIADTSTAFFCYYVHYWEKGGIQQVKGPFRSNSISLDNLKPSRVYCLQVQAQLLWNKSNIFRVGHLSNIS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names AF-1, IFNGT1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P38484
HTS Code 3002150000
Gene ID 3460
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-IFNGR2 Antibody 25ul

Anti-IFNGR2 Antibody 25ul