TXNRD1,GRIM-12
  • TXNRD1,GRIM-12

Anti-TXNRD1 Antibody 25ul

Ref: AN-HPA001395-25ul
Anti-TXNRD1

Información del producto

Polyclonal Antibody against Human TXNRD1, Gene description: thioredoxin reductase 1, Alternative Gene Names: GRIM-12, Trxr1, TXNR, Validated applications: IHC, WB, Uniprot ID: Q16881, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TXNRD1
Gene Description thioredoxin reductase 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence SCEDGRALEGTLSELAAETDLPVVFVKQRKIGGHGPTLKAYQEGRLQKLLKMNGPEDLPKSYDYDLIIIGGGSGGLAAAKEAAQYGKKVMVLDFVTPTPLGTRWGLGGTCVNVGCIPKKLMHQAALLGQALQDSRNYG
Immunogen SCEDGRALEGTLSELAAETDLPVVFVKQRKIGGHGPTLKAYQEGRLQKLLKMNGPEDLPKSYDYDLIIIGGGSGGLAAAKEAAQYGKKVMVLDFVTPTPLGTRWGLGGTCVNVGCIPKKLMHQAALLGQALQDSRNYG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names GRIM-12, Trxr1, TXNR
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q16881
HTS Code 3002150000
Gene ID 7296
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TXNRD1 Antibody 25ul

Anti-TXNRD1 Antibody 25ul