FHL1,bA535K18.1
  • FHL1,bA535K18.1

Anti-FHL1 Antibody 100ul

Ref: AN-HPA001391-100ul
Anti-FHL1

Información del producto

Polyclonal Antibody against Human FHL1, Gene description: four and a half LIM domains 1, Alternative Gene Names: bA535K18.1, FHL1B, FLH1A, KYO-T, MGC111107, SLIM1, XMPMA, Validated applications: IHC, Uniprot ID: Q13642, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name FHL1
Gene Description four and a half LIM domains 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence RFTAVEDQYYCVDCYKNFVAKKCAGCKNPITGFGKGSSVVAYEGQSWHDYCFHCKIRRAPPLSNN
Immunogen RFTAVEDQYYCVDCYKNFVAKKCAGCKNPITGFGKGSSVVAYEGQSWHDYCFHCKIRRAPPLSNN
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names bA535K18.1, FHL1B, FLH1A, KYO-T, MGC111107, SLIM1, XMPMA
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q13642
HTS Code 3002150000
Gene ID 2273
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-FHL1 Antibody 100ul

Anti-FHL1 Antibody 100ul