ERBB2,CD340,HER-2
  • ERBB2,CD340,HER-2

Anti-ERBB2 Antibody 25ul

Ref: AN-HPA001338-25ul
Anti-ERBB2

Información del producto

Polyclonal Antibody against Human ERBB2, Gene description: erb-b2 receptor tyrosine kinase 2, Alternative Gene Names: CD340, HER-2, HER2, NEU, NGL, Validated applications: ICC, WB, Uniprot ID: P04626, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ERBB2
Gene Description erb-b2 receptor tyrosine kinase 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, WB
Sequence LVSEFSRMARDPQRFVVIQNEDLGPASPLDSTFYRSLLEDDDMGDLVDAEEYLVPQQGFFCPDPAPGAGGMVHHRHRSSSTRSGGGDLTLGLEPSEEEAPRSPLAPSEGAGSDVFDGDGAPHR
Immunogen LVSEFSRMARDPQRFVVIQNEDLGPASPLDSTFYRSLLEDDDMGDLVDAEEYLVPQQGFFCPDPAPGAGGMVHHRHRSSSTRSGGGDLTLGLEPSEEEAPRSPLAPSEGAGSDVFDGDGAPHR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CD340, HER-2, HER2, NEU, NGL
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P04626
HTS Code 3002150000
Gene ID 2064
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ERBB2 Antibody 25ul

Anti-ERBB2 Antibody 25ul