HIF1A,bHLHe78
  • HIF1A,bHLHe78

Anti-HIF1A Antibody 25ul

Ref: AN-HPA001275-25ul
Anti-HIF1A

Información del producto

Polyclonal Antibody against Human HIF1A, Gene description: hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor), Alternative Gene Names: bHLHe78, HIF-1alpha, HIF1, MOP1, PASD8, Validated applications: WB, Uniprot ID: Q16665, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name HIF1A
Gene Description hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB
Sequence KSHPRSPNVLSVALSQRTTVPEEELNPKILALQNAQRKRKMEHDGSLFQAVGIGTLLQQPDDHAATTSLSWKRVKGCKSSEQNGMEQKTIILIPSDLACRLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALD
Immunogen KSHPRSPNVLSVALSQRTTVPEEELNPKILALQNAQRKRKMEHDGSLFQAVGIGTLLQQPDDHAATTSLSWKRVKGCKSSEQNGMEQKTIILIPSDLACRLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names bHLHe78, HIF-1alpha, HIF1, MOP1, PASD8
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q16665
HTS Code 3002150000
Gene ID 3091
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-HIF1A Antibody 25ul

Anti-HIF1A Antibody 25ul