CKAP4,CLIMP-63
  • CKAP4,CLIMP-63

Anti-CKAP4 Antibody 25ul

Ref: AN-HPA001225-25ul
Anti-CKAP4

Información del producto

Polyclonal Antibody against Human CKAP4, Gene description: cytoskeleton-associated protein 4, Alternative Gene Names: CLIMP-63, ERGIC-63, P63, Validated applications: ICC, WB, Uniprot ID: Q07065, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CKAP4
Gene Description cytoskeleton-associated protein 4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, ICC
Sequence LKDLSDGIHVVKDARERDFTSLENTVEERLTELTKSINDNIAIFTEVQKRSQKEINDMKAKVASLEESEGNKQDLKALKEAVKEIQTSAKSREWDMEALRSTLQTMES
Immunogen LKDLSDGIHVVKDARERDFTSLENTVEERLTELTKSINDNIAIFTEVQKRSQKEINDMKAKVASLEESEGNKQDLKALKEAVKEIQTSAKSREWDMEALRSTLQTMES
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CLIMP-63, ERGIC-63, P63
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q07065
HTS Code 3002150000
Gene ID 10970
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CKAP4 Antibody 25ul

Anti-CKAP4 Antibody 25ul