SNRPD3,Sm-D3,SMD3
  • SNRPD3,Sm-D3,SMD3

Anti-SNRPD3 Antibody 25ul

Ref: AN-HPA001170-25ul
Anti-SNRPD3

Información del producto

Polyclonal Antibody against Human SNRPD3, Gene description: small nuclear ribonucleoprotein D3 polypeptide 18kDa, Alternative Gene Names: Sm-D3, SMD3, Validated applications: ICC, IHC, WB, Uniprot ID: P62318, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SNRPD3
Gene Description small nuclear ribonucleoprotein D3 polypeptide 18kDa
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications WB, IHC, ICC
Sequence KVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNAPMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGRGNI
Immunogen KVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNAPMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGRGNI
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Sm-D3, SMD3
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P62318
HTS Code 3002150000
Gene ID 6634
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SNRPD3 Antibody 25ul

Anti-SNRPD3 Antibody 25ul