RIBC1,FLJ32783
  • RIBC1,FLJ32783

Anti-RIBC1 Antibody 25ul

Ref: AN-HPA001150-25ul
Anti-RIBC1

Información del producto

Polyclonal Antibody against Human RIBC1, Gene description: RIB43A domain with coiled-coils 1, Alternative Gene Names: FLJ32783, Validated applications: ICC, Uniprot ID: Q8N443, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name RIBC1
Gene Description RIB43A domain with coiled-coils 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence CERQREQKANLAEIQHQSTSDLLTENPQVAQHPMAPYRVLPYCWKGMTPEQQAAIRKEQEVQRSKKQAHRQAEKTLDTEWKSQTMSSAQAVLELEEQERELCAVFQRGLGSFNQ
Immunogen CERQREQKANLAEIQHQSTSDLLTENPQVAQHPMAPYRVLPYCWKGMTPEQQAAIRKEQEVQRSKKQAHRQAEKTLDTEWKSQTMSSAQAVLELEEQERELCAVFQRGLGSFNQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ32783
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8N443
HTS Code 3002150000
Gene ID 158787
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-RIBC1 Antibody 25ul

Anti-RIBC1 Antibody 25ul