DTD2,C14orf126
  • DTD2,C14orf126

Anti-DTD2 Antibody 100ul

Ref: AN-HPA001117-100ul
Anti-DTD2

Información del producto

Polyclonal Antibody against Human DTD2, Gene description: D-tyrosyl-tRNA deacylase 2 (putative), Alternative Gene Names: C14orf126, MGC9912, Validated applications: ICC, IHC, Uniprot ID: Q96FN9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name DTD2
Gene Description D-tyrosyl-tRNA deacylase 2 (putative)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence WVEVQRGLVIYVCFFKGADKELLPKMVNTLLNVKLSETENGKHVSILDLPGNILIIPQATLGGRLKGRNMQYHSNSGKEEGFELYSQFVTLCEKEVAANSKCAEARVVVEHGTYGNRQVLKLDTNGPFTHLIFE
Immunogen WVEVQRGLVIYVCFFKGADKELLPKMVNTLLNVKLSETENGKHVSILDLPGNILIIPQATLGGRLKGRNMQYHSNSGKEEGFELYSQFVTLCEKEVAANSKCAEARVVVEHGTYGNRQVLKLDTNGPFTHLIFE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C14orf126, MGC9912
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96FN9
HTS Code 3002150000
Gene ID 112487
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-DTD2 Antibody 100ul

Anti-DTD2 Antibody 100ul