TAF1,BA2R,CCG1,CCGS
  • TAF1,BA2R,CCG1,CCGS

Anti-TAF1 Antibody 100ul

Ref: AN-HPA001075-100ul
Anti-TAF1

Información del producto

Polyclonal Antibody against Human TAF1, Gene description: TAF1 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 250kDa, Alternative Gene Names: BA2R, CCG1, CCGS, DYT3, DYT3/TAF1, KAT4, NSCL2, TAF2A, TAFII250, Validated applications: ICC, IHC, Uniprot ID: P21675, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TAF1
Gene Description TAF1 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 250kDa
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence SDSDVGSGGIRPKQPRMLQENTRMDMENEESMMSYEGDGGEASHGLEDSNISYGSYEEPDPKSNTQDTSFSSIGGYEVSEEEEDEEEEEQRSGPSVLSQVHLSEDEEDSEDFHSIAGDSDLDS
Immunogen SDSDVGSGGIRPKQPRMLQENTRMDMENEESMMSYEGDGGEASHGLEDSNISYGSYEEPDPKSNTQDTSFSSIGGYEVSEEEEDEEEEEQRSGPSVLSQVHLSEDEEDSEDFHSIAGDSDLDS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BA2R, CCG1, CCGS, DYT3, DYT3/TAF1, KAT4, NSCL2, TAF2A, TAFII250
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P21675
HTS Code 3002150000
Gene ID 6872
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TAF1 Antibody 100ul

Anti-TAF1 Antibody 100ul