GOLGA5,golgin-84
  • GOLGA5,golgin-84

Anti-GOLGA5 Antibody 100ul

Ref: AN-HPA000992-100ul
Anti-GOLGA5

Información del producto

Polyclonal Antibody against Human GOLGA5, Gene description: golgin A5, Alternative Gene Names: golgin-84, GOLIM5, ret-II, rfg5, Validated applications: ICC, IHC, WB, Uniprot ID: Q8TBA6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name GOLGA5
Gene Description golgin A5
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence SSVNPSVTTIKTIEENSFGSQTHEAASNSDSSHEGQEESSKENVSSNAACPDHTPTPNDDGKSHELSNLRLENQLLRNEVQSLNQEMASLLQRSKETQEELNKARARVEKWNADHSKSDRMTRGLRAQVDDLTEAVAAKDSQLAVLKV
Immunogen SSVNPSVTTIKTIEENSFGSQTHEAASNSDSSHEGQEESSKENVSSNAACPDHTPTPNDDGKSHELSNLRLENQLLRNEVQSLNQEMASLLQRSKETQEELNKARARVEKWNADHSKSDRMTRGLRAQVDDLTEAVAAKDSQLAVLKV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names golgin-84, GOLIM5, ret-II, rfg5
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8TBA6
HTS Code 3002150000
Gene ID 9950
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-GOLGA5 Antibody 100ul

Anti-GOLGA5 Antibody 100ul