APEX1,APE,APE-1
  • APEX1,APE,APE-1

Anti-APEX1 Antibody 25ul

Ref: AN-HPA000956-25ul
Anti-APEX1

Información del producto

Polyclonal Antibody against Human APEX1, Gene description: APEX nuclease (multifunctional DNA repair enzyme) 1, Alternative Gene Names: APE, APE-1, APEN, APEX, APX, HAP1, REF-1, REF1, Validated applications: ICC, Uniprot ID: P27695, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name APEX1
Gene Description APEX nuclease (multifunctional DNA repair enzyme) 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence DKEGYSGVGLLSRQCPLKVSYGIGEEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQEGAPHR
Immunogen DKEGYSGVGLLSRQCPLKVSYGIGEEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQEGAPHR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names APE, APE-1, APEN, APEX, APX, HAP1, REF-1, REF1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P27695
HTS Code 3002150000
Gene ID 328
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-APEX1 Antibody 25ul

Anti-APEX1 Antibody 25ul