ANGEL1,Ccr4e
  • ANGEL1,Ccr4e

Anti-ANGEL1 Antibody 25ul

Ref: AN-HPA000948-25ul
Anti-ANGEL1

Información del producto

Polyclonal Antibody against Human ANGEL1, Gene description: angel homolog 1 (Drosophila), Alternative Gene Names: Ccr4e, KIAA0759, Validated applications: IHC, Uniprot ID: Q9UNK9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ANGEL1
Gene Description angel homolog 1 (Drosophila)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence PLWPSSLGITDCCQYVTSCHPKRSERRKYGRDFLLRFRFCSIACQRPVGLVLMEGVTDTKPERPAGWAESVLEEDASELEPAFSRTVGTIQHCLHLTSVYTHFLPQRGRPEVTTMPLGLGMTVDYIFFSAESCENGNRTDHRLYRDG
Immunogen PLWPSSLGITDCCQYVTSCHPKRSERRKYGRDFLLRFRFCSIACQRPVGLVLMEGVTDTKPERPAGWAESVLEEDASELEPAFSRTVGTIQHCLHLTSVYTHFLPQRGRPEVTTMPLGLGMTVDYIFFSAESCENGNRTDHRLYRDG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Ccr4e, KIAA0759
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UNK9
HTS Code 3002150000
Gene ID 23357
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ANGEL1 Antibody 25ul

Anti-ANGEL1 Antibody 25ul