SERPINA1,A1A,A1AT
  • SERPINA1,A1A,A1AT

Anti-SERPINA1 Antibody 100ul

Ref: AN-HPA000927-100ul
Anti-SERPINA1

Información del producto

Polyclonal Antibody against Human SERPINA1, Gene description: serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1, Alternative Gene Names: A1A, A1AT, AAT, alpha-1-antitrypsin, alpha1AT, PI, PI1, Validated applications: ICC, IHC, WB, Uniprot ID: P01009, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SERPINA1
Gene Description serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence HDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYGAPHR
Immunogen HDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYGAPHR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names A1A, A1AT, AAT, alpha-1-antitrypsin, alpha1AT, PI, PI1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P01009
HTS Code 3002150000
Gene ID 5265
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SERPINA1 Antibody 100ul

Anti-SERPINA1 Antibody 100ul