DGCR2,DGS-C,IDD
  • DGCR2,DGS-C,IDD

Anti-DGCR2 Antibody 100ul

Ref: AN-HPA000873-100ul
Anti-DGCR2

Información del producto

Polyclonal Antibody against Human DGCR2, Gene description: DiGeorge syndrome critical region gene 2, Alternative Gene Names: DGS-C, IDD, KIAA0163, LAN, SEZ-12, Validated applications: IHC, Uniprot ID: P98153, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name DGCR2
Gene Description DiGeorge syndrome critical region gene 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence RFSRKCPTGWHHYEGTASCYRVYLSGENYWDAAQTCQRLNGSLATFSTDQELRFVLAQEWDQPERSFGWKDQRKLWVGYQYVITGRNRSLEGRWEVAFKGSSEVFLPPDPIFASAMSENDNVFCAQLQCFHFPTLRHHDLHSWHAESCYEKSSFLCKRSQTCVDIKDNVVDEGFYFTPK
Immunogen RFSRKCPTGWHHYEGTASCYRVYLSGENYWDAAQTCQRLNGSLATFSTDQELRFVLAQEWDQPERSFGWKDQRKLWVGYQYVITGRNRSLEGRWEVAFKGSSEVFLPPDPIFASAMSENDNVFCAQLQCFHFPTLRHHDLHSWHAESCYEKSSFLCKRSQTCVDIKDNVVDEGFYFTPK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DGS-C, IDD, KIAA0163, LAN, SEZ-12
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P98153
HTS Code 3002150000
Gene ID 9993
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-DGCR2 Antibody 100ul

Anti-DGCR2 Antibody 100ul