FKBP3,FKBP-25,PPIase
  • FKBP3,FKBP-25,PPIase

Anti-FKBP3 Antibody 25ul

Ref: AN-HPA000864-25ul
Anti-FKBP3

Información del producto

Polyclonal Antibody against Human FKBP3, Gene description: FK506 binding protein 3, 25kDa, Alternative Gene Names: FKBP-25, PPIase, Validated applications: ICC, IHC, WB, Uniprot ID: Q00688, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name FKBP3
Gene Description FK506 binding protein 3, 25kDa
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications WB, IHC, ICC
Sequence LPKKDIIKFLQEHGSDSFLAEHKLLGNIKNVAKTANKDHLVTAYNHLFETKRFKGTESISKVSEQVKNVKLNEDKPKETKSEETLDEGPPKYTKSVLKKGDKTNFPKKGDVVHCWYTGTLQDGT
Immunogen LPKKDIIKFLQEHGSDSFLAEHKLLGNIKNVAKTANKDHLVTAYNHLFETKRFKGTESISKVSEQVKNVKLNEDKPKETKSEETLDEGPPKYTKSVLKKGDKTNFPKKGDVVHCWYTGTLQDGT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FKBP-25, PPIase
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q00688
HTS Code 3002150000
Gene ID 2287
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-FKBP3 Antibody 25ul

Anti-FKBP3 Antibody 25ul