INF2,C14orf151
  • INF2,C14orf151

Anti-INF2 Antibody 25ul

Ref: AN-HPA000724-25ul
Anti-INF2

Información del producto

Polyclonal Antibody against Human INF2, Gene description: inverted formin, FH2 and WH2 domain containing, Alternative Gene Names: C14orf151, C14orf173, MGC13251, Validated applications: IHC, Uniprot ID: Q27J81, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name INF2
Gene Description inverted formin, FH2 and WH2 domain containing
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence GVARISDALLQLTCVSCVRAVMNSRQGIEYILSNQGYVRQLSQALDTSNVMVKKQVFELLAALCIYSPEGHVLTLDALDHYKTVCSQQYRFSIVMNELSGSDNVPYVVTLLSVINAVILGPEDLRARTQLRNEFIGLQLLDVLAR
Immunogen GVARISDALLQLTCVSCVRAVMNSRQGIEYILSNQGYVRQLSQALDTSNVMVKKQVFELLAALCIYSPEGHVLTLDALDHYKTVCSQQYRFSIVMNELSGSDNVPYVVTLLSVINAVILGPEDLRARTQLRNEFIGLQLLDVLAR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C14orf151, C14orf173, MGC13251
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q27J81
HTS Code 3002150000
Gene ID 64423
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-INF2 Antibody 25ul

Anti-INF2 Antibody 25ul