OSBPL3,KIAA0704
  • OSBPL3,KIAA0704

Anti-OSBPL3 Antibody 100ul

Ref: AN-HPA000691-100ul
Anti-OSBPL3

Información del producto

Polyclonal Antibody against Human OSBPL3, Gene description: oxysterol binding protein-like 3, Alternative Gene Names: KIAA0704, ORP-3, ORP3, OSBP3, Validated applications: ICC, IHC, WB, Uniprot ID: Q9H4L5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name OSBPL3
Gene Description oxysterol binding protein-like 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence TLDFGEEKNYSDGSETSSEFSKMQEDLCHIAHKVYFTLRSAFNIMSAEREKLKQLMEQDASSSPSAQVIGLKNALSSALAQNTDLKERLRRIHAESLLLDSPAVAKSGDNLAEE
Immunogen TLDFGEEKNYSDGSETSSEFSKMQEDLCHIAHKVYFTLRSAFNIMSAEREKLKQLMEQDASSSPSAQVIGLKNALSSALAQNTDLKERLRRIHAESLLLDSPAVAKSGDNLAEE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA0704, ORP-3, ORP3, OSBP3
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9H4L5
HTS Code 3002150000
Gene ID 26031
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-OSBPL3 Antibody 100ul

Anti-OSBPL3 Antibody 100ul