LGALS3BP,90K
  • LGALS3BP,90K

Anti-LGALS3BP Antibody 100ul

Ref: AN-HPA000554-100ul
Anti-LGALS3BP

Información del producto

Polyclonal Antibody against Human LGALS3BP, Gene description: lectin, galactoside-binding, soluble, 3 binding protein, Alternative Gene Names: 90K, BTBD17B, CyCAP, gp90, M2BP, MAC-2-BP, TANGO10B, Validated applications: IHC, WB, Uniprot ID: Q08380, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name LGALS3BP
Gene Description lectin, galactoside-binding, soluble, 3 binding protein
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence RHERDAGVVCTNETRSTHTLDLSRELSEALGQIFDSQRGCDLSISVNVQGEDALGFCGHTVILTANLEAQALWKEPGSNVTMSVDAECVPMVRDLLRYFYSRRIDITLSSVKCFHKLAS
Immunogen RHERDAGVVCTNETRSTHTLDLSRELSEALGQIFDSQRGCDLSISVNVQGEDALGFCGHTVILTANLEAQALWKEPGSNVTMSVDAECVPMVRDLLRYFYSRRIDITLSSVKCFHKLAS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names 90K, BTBD17B, CyCAP, gp90, M2BP, MAC-2-BP, TANGO10B
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q08380
HTS Code 3002150000
Gene ID 3959
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-LGALS3BP Antibody 100ul

Anti-LGALS3BP Antibody 100ul