ITIH6,ITIH5L,UNQ6369
  • ITIH6,ITIH5L,UNQ6369

Anti-ITIH6 Antibody 25ul

Ref: AN-HPA000506-25ul
Anti-ITIH6

Información del producto

Polyclonal Antibody against Human ITIH6, Gene description: inter-alpha-trypsin inhibitor heavy chain family, member 6, Alternative Gene Names: ITIH5L, UNQ6369, Validated applications: IHC, Uniprot ID: Q6UXX5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ITIH6
Gene Description inter-alpha-trypsin inhibitor heavy chain family, member 6
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence RLNYLGGLVGASPWAVFPNYFGGSELVVAGQVQPGKQELGIHLAARGPKDQLLVAHHSEGATNNSQKAFGCPGEPAPNVAHFIRRLWAYVTIGELLDAHFQARDTTTRHLLAAKVLNLS
Immunogen RLNYLGGLVGASPWAVFPNYFGGSELVVAGQVQPGKQELGIHLAARGPKDQLLVAHHSEGATNNSQKAFGCPGEPAPNVAHFIRRLWAYVTIGELLDAHFQARDTTTRHLLAAKVLNLS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ITIH5L, UNQ6369
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6UXX5
HTS Code 3002150000
Gene ID 347365
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ITIH6 Antibody 25ul

Anti-ITIH6 Antibody 25ul