CLCN5,ClC-5,CLC5
  • CLCN5,ClC-5,CLC5

Anti-CLCN5 Antibody 100ul

Ref: AN-HPA000401-100ul
Anti-CLCN5

Información del producto

Polyclonal Antibody against Human CLCN5, Gene description: chloride channel, voltage-sensitive 5, Alternative Gene Names: ClC-5, CLC5, DENTS, hCIC-K2, hClC-K2, NPHL1, NPHL2, XLRH, XRN, Validated applications: IHC, Uniprot ID: P51795, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CLCN5
Gene Description chloride channel, voltage-sensitive 5
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence EAKEEFAHKTLAMDVMKPRRNDPLLTVLTQDSMTVEDVETIISETTYSGFPVVVSRESQRLVGFVLRRDLIISIENARKKQDGVVSTSIIYFTEHSPPLPPYTPPTLKLQNILDLSPFTVTD
Immunogen EAKEEFAHKTLAMDVMKPRRNDPLLTVLTQDSMTVEDVETIISETTYSGFPVVVSRESQRLVGFVLRRDLIISIENARKKQDGVVSTSIIYFTEHSPPLPPYTPPTLKLQNILDLSPFTVTD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ClC-5, CLC5, DENTS, hCIC-K2, hClC-K2, NPHL1, NPHL2, XLRH, XRN
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P51795
HTS Code 3002150000
Gene ID 1184
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CLCN5 Antibody 100ul

Anti-CLCN5 Antibody 100ul