IRX2 DNAxPab View larger

Rabbit polyclonal antibody raised against a full-length human IRX2 DNA using DNAx™ Immune technology.

AB-H00153572-W01P

New product

IRX2 DNAxPab

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name IRX2
Gene Alias IRXA2
Gene Description iroquois homeobox 2
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Immunogen Prot. Seq MSYPQGYLYQAPGSLALYSCPAYGASALAAPRSEELARSASGSAFSPYPGSAAFTAQAATGFGSPLQYSADAAAAAAGFPSYMGAPYDAHTTGMTGAISYHPYGSAAYPYQLNDPAYRKNATRDATATLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWAPRNKSEDEDEDEGDATRSKDESPDKAQEGTETSAEDEGISLHVDSLTDHSCSAESDGEKLPCRAGDPLCESGSE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IRX2 (NP_150366.1, 1 a.a. ~ 471 a.a) full-length human DNA
Storage Buffer In 1x PBS, pH 7.4
Gene ID 153572

More info

Rabbit polyclonal antibody raised against a full-length human IRX2 DNA using DNAx™ Immune technology.

Enviar uma mensagem

Rabbit polyclonal antibody raised against a full-length human IRX2 DNA using DNAx™ Immune technology.

Rabbit polyclonal antibody raised against a full-length human IRX2 DNA using DNAx™ Immune technology.