Exendin-4 polyclonal antibody
  • Exendin-4 polyclonal antibody

Exendin-4 polyclonal antibody

Ref: AB-PAB5186
Exendin-4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of exendin-4.
Información adicional
Size 150 ug
Storage Conditions Store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IP,EIA
Immunogen Prot. Seq HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
Form Liquid
Recomended Dilution The optimal working dilution should be determined by the end user.
Immunogen A synthetic peptide (conjugated with KLH) corresponding to exendin-4.
Storage Buffer In PBS, pH 7.4 (50% glycerol, 0.02% sodium azide)
Iso type IgG

Enviar uma mensagem


Exendin-4 polyclonal antibody

Exendin-4 polyclonal antibody