Exendin-3 polyclonal antibody
  • Exendin-3 polyclonal antibody

Exendin-3 polyclonal antibody

Ref: AB-PAB5185
Exendin-3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of exendin-3.
Información adicional
Size 150 ug
Storage Conditions Store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IP,EIA
Immunogen Prot. Seq HSDGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
Form Liquid
Recomended Dilution The optimal working dilution should be determined by the end user.
Quality control testing Antibody Reactive Against synthetic peptide.
Immunogen A synthetic peptide (conjugated with KLH) corresponding to exendin-3.
Storage Buffer In PBS, pH 7.5 (50% glycerol, 0.01% thimerosal)

Enviar uma mensagem


Exendin-3 polyclonal antibody

Exendin-3 polyclonal antibody