Adm polyclonal antibody
  • Adm polyclonal antibody

Adm polyclonal antibody

Ref: AB-PAB5087
Adm polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of Adm.
Información adicional
Size 150 ug
Gene Name Adm
Gene Alias Ap|H39316|RATAP
Gene Description adrenomedullin
Storage Conditions Store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IP,EIA
Immunogen Prot. Seq YRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY
Form Liquid
Recomended Dilution The optimal working dilution should be determined by the end user.
Antigen species Target species Rat
Quality control testing Antibody Reactive Against synthetic peptide.
Immunogen A synthetic peptide (conjugated with KLH) corresponding to rat Adm.
Storage Buffer In PBS, pH 7.5 (50% glycerol, 0.01% thimerosal)
Gene ID 25026

Enviar uma mensagem


Adm polyclonal antibody

Adm polyclonal antibody