Nppb polyclonal antibody
  • Nppb polyclonal antibody

Nppb polyclonal antibody

Ref: AB-PAB5082
Nppb polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of Nppb.
Información adicional
Size 150 ug
Gene Name Nppb
Gene Alias BNP|Bnf
Gene Description natriuretic peptide precursor B
Storage Conditions Store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IP,EIA
Immunogen Prot. Seq NSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF
Form Liquid
Recomended Dilution The optimal working dilution should be determined by the end user.
Antigen species Target species Rat
Quality control testing Antibody Reactive Against synthetic peptide.
Immunogen A synthetic peptide (conjugated with KLH) corresponding to rat Nppb.
Storage Buffer In PBS, pH 7.5 (50% glycerol, 0.01% thimerosal)
Gene ID 25105

Enviar uma mensagem


Nppb polyclonal antibody

Nppb polyclonal antibody