Iapp polyclonal antibody
  • Iapp polyclonal antibody

Iapp polyclonal antibody

Ref: AB-PAB5080
Iapp polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of Iapp.
Información adicional
Size 150 ug
Gene Name Iapp
Gene Alias -
Gene Description islet amyloid polypeptide
Storage Conditions Store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IP,EIA
Immunogen Prot. Seq KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY
Form Liquid
Recomended Dilution The optimal working dilution should be determined by the end user.
Antigen species Target species Rat
Quality control testing Antibody Reactive Against synthetic peptide.
Immunogen A synthetic peptide (conjugated with KLH) corresponding to rat Iapp.
Storage Buffer In PBS, pH 7.5 (50% glycerol, 0.01% thimerosal)
Gene ID 24476

Enviar uma mensagem


Iapp polyclonal antibody

Iapp polyclonal antibody