GAL polyclonal antibody
  • GAL polyclonal antibody

GAL polyclonal antibody

Ref: AB-PAB5055
GAL polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of GAL.
Información adicional
Size 150 ug
Gene Name GAL
Gene Alias GALN|GLNN|GMAP|MGC40167
Gene Description galanin prepropeptide
Storage Conditions Store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IP,EIA
Immunogen Prot. Seq GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS
Form Liquid
Recomended Dilution The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Quality control testing Antibody Reactive Against synthetic peptide.
Immunogen A synthetic peptide (conjugated with KLH) corresponding to human GAL.
Storage Buffer In PBS, pH 7.5 (50% glycerol, 0.01% thimerosal)
Gene ID 51083

Enviar uma mensagem


GAL polyclonal antibody

GAL polyclonal antibody