View larger
Rabbit polyclonal antibody raised against synthetic peptide of NPPB.
AB-PAB4975
New product
NPPB polyclonal antibody
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 150 ug |
| Gene Name | NPPB |
| Gene Alias | BNP |
| Gene Description | natriuretic peptide precursor B |
| Storage Conditions | Store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | IP,EIA |
| Immunogen Prot. Seq | SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH |
| Form | Liquid |
| Recomended Dilution | The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against synthetic peptide. |
| Immunogen | A synthetic peptide (conjugated with KLH) corresponding to human NPPB. |
| Storage Buffer | In PBS, pH 7.5 (50% glycerol, 0.01% thimerosal) |
| Gene ID | 4879 |
More info
Rabbit polyclonal antibody raised against synthetic peptide of NPPB.